Atlas Antibodies Anti-SLC16A1 Antibody

상품 한눈에 보기

인체 SLC16A1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 Orthogonal Validation으로 검증된 신뢰성 높은 제품. Rabbit 호스트, Affinity purification 방식으로 정제됨.

카탈로그번호: HPA071055-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071055-100 Anti-SLC16A1 Antibody, solute carrier family 16 (monocarboxylate transporter), member 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071055-25 Anti-SLC16A1 Antibody, solute carrier family 16 (monocarboxylate transporter), member 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SLC16A1 Antibody

Anti-SLC16A1 Antibody

solute carrier family 16 (monocarboxylate transporter), member 1

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SLC16A1

Alternative Gene Names

MCT, MCT1

Open Datasheet

Target Information

항목	내용
Target Protein	solute carrier family 16 (monocarboxylate transporter), member 1
Target Gene	SLC16A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000032902 (66%), Rat ENSRNOG00000019996 (65%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand