
Atlas Antibodies Anti-SLC16A1 Antibody
인체 SLC16A1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 Orthogonal Validation으로 검증된 신뢰성 높은 제품. Rabbit 호스트, Affinity purification 방식으로 정제됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SLC16A1 Antibody
solute carrier family 16 (monocarboxylate transporter), member 1
Recommended Applications
IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SLC16A1
Alternative Gene Names
MCT, MCT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | solute carrier family 16 (monocarboxylate transporter), member 1 |
| Target Gene | SLC16A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000032902 (66%), Rat ENSRNOG00000019996 (65%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SLC16A10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC16A12 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC16A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLC15A4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SLAMF7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|