CacheBy
Atlas Antibodies Anti-SLC16A12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC16A12 Antibody

상품 한눈에 보기

Human SLC16A12 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조됨. ICC 등 다양한 응용에 적합하며 PrEST 항원으로 특이적 정제됨. Human에 대한 반응성 검증 완료. 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA037587-100 Anti-SLC16A12 Antibody, solute carrier family 16, member 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037587-25 Anti-SLC16A12 Antibody, solute carrier family 16, member 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC16A12 Antibody

Anti-SLC16A12 Antibody

Target Information

  • Protein: Solute carrier family 16, member 12
  • Gene: SLC16A12
  • Alternative Gene Name: MCT12

Product Description

Polyclonal antibody against human SLC16A12.

  • Immunocytochemistry (ICC)

Antigen Information

  • Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    ITLKEDHTTPEQNHVCRTQKEDIKRVSPYSSLTKEWAQTCLCCCLQQEYS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000009378 62%
Rat ENSRNOG00000021916 60%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.