CacheBy
Atlas Antibodies Anti-SLC15A4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SLC15A4 Antibody

상품 한눈에 보기

인간 SLC15A4 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit에서 생산된 IgG 형태이며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었으며, 높은 종 간 항원 서열 유사성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA016713-100 Anti-SLC15A4 Antibody, solute carrier family 15 (oligopeptide transporter), member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016713-25 Anti-SLC15A4 Antibody, solute carrier family 15 (oligopeptide transporter), member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SLC15A4 Antibody

Anti-SLC15A4 Antibody

Target: solute carrier family 15 (oligopeptide transporter), member 4
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SLC15A4


Alternative Gene Names

  • PHT1
  • PTR4

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Solute carrier family 15 (oligopeptide transporter), member 4
Target Gene SLC15A4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000000962 (85%), Mouse ENSMUSG00000029416 (85%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence

TKPPDGSAFTDMFKILTYSCCSQKRSGERQSNGEGIGVFQQSSKQSLFDSCKMSHGGPFTEEKVEDVK

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.