Atlas Antibodies Anti-SKA3 Antibody

상품 한눈에 보기

Human SKA3 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC에 적합하며, 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Mouse, Rat과 부분적 교차 반응 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039272-100 Anti-SKA3 Antibody, spindle and kinetochore associated complex subunit 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039272-25 Anti-SKA3 Antibody, spindle and kinetochore associated complex subunit 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: spindle and kinetochore associated complex subunit 3 (SKA3)
Type: Polyclonal Antibody against Human SKA3

IHC (Immunohistochemistry)
WB (Western Blot) – Recombinant expression validation using target protein overexpression

Polyclonal antibody raised in rabbit against Human SKA3.
Validated for use in IHC and WB with recombinant expression verification.

C13orf3, MGC4832, RAMA1

항목	내용
Target Protein	spindle and kinetochore associated complex subunit 3
Target Gene	SKA3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	NSVHEQEAINSDPELSNCENFQKTDVKDDLSDPPVASSCISEKSPRSPQLSDFGLERYIVSQVLPNPPQAVNNYKEEPVIVTPPTKQ
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000021965 (54%), Rat ENSRNOG00000021847 (44%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand