Atlas Antibodies Anti-SKA2 Antibody

상품 한눈에 보기

Human SKA2 단백질을 인식하는 토끼 폴리클로날 항체로, spindle 및 kinetochore 관련 단백질 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원으로 친화 정제됨. 사람에 대한 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA059235-100 Anti-SKA2 Antibody, spindle and kinetochore associated complex subunit 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA059235-25 Anti-SKA2 Antibody, spindle and kinetochore associated complex subunit 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: spindle and kinetochore associated complex subunit 2 (SKA2)
Type: Polyclonal Antibody against Human SKA2

Polyclonal antibody raised in rabbit against human SKA2, a spindle and kinetochore associated complex subunit.

항목	내용
Target Protein	spindle and kinetochore associated complex subunit 2
Target Gene	SKA2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
Verified Species Reactivity	Human
Interspecies Identity	Mouse (85%), Rat (81%)