CacheBy
Atlas Antibodies Anti-SKA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SKA2 Antibody

상품 한눈에 보기

Human SKA2 단백질을 인식하는 토끼 폴리클로날 항체로, spindle 및 kinetochore 관련 단백질 연구에 적합. IHC 등 다양한 응용 가능. PrEST 항원으로 친화 정제됨. 사람에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059235-100 Anti-SKA2 Antibody, spindle and kinetochore associated complex subunit 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059235-25 Anti-SKA2 Antibody, spindle and kinetochore associated complex subunit 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SKA2 Antibody

Anti-SKA2 Antibody

Target: spindle and kinetochore associated complex subunit 2 (SKA2)
Type: Polyclonal Antibody against Human SKA2

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human SKA2, a spindle and kinetochore associated complex subunit.

Alternative Gene Names

  • FAM33A
  • FLJ12758

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein spindle and kinetochore associated complex subunit 2
Target Gene SKA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKS
Verified Species Reactivity Human
Interspecies Identity Mouse (85%), Rat (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.