Atlas Antibodies Anti-SIX6 Antibody

상품 한눈에 보기

Human SIX6 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다. SIX6 및 관련 유전자 연구에 활용 가능합니다.

카탈로그번호: HPA001403-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA001403-100 Anti-SIX6 Antibody, SIX homeobox 6 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA001403-25 Anti-SIX6 Antibody, SIX homeobox 6 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SIX6 Antibody

Anti-SIX6 Antibody

Target Information

Target Protein: SIX homeobox 6
Target Gene: SIX6
Alternative Gene Names: OPTX2, Six9

Product Description

Polyclonal antibody against human SIX6.

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)
Immunocytochemistry (ICC)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

YQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGSGRALRAEGDGTPEVLGVATSPAASLSSKAATSAISITSSDSECDI

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000021099	96%
Rat	ENSRNOG00000006296	96%

Antibody Properties

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet