
Thermo Fisher Scientific LRTOMT Polyclonal Antibody
LRTOMT 단백질을 표적으로 하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody입니다. Western blot 및 IHC(P) 실험에 적합하며, 인간, 마우스, 랫트 반응성을 보입니다. 고순도 친화 크로마토그래피 정제 제품으로 연구용으로만 사용됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.5–1 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884858 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-114402_LRTOMT_Q8WZ04-1_Rabbit.svg)
(이미지: PA5-114402_LRTOMT_Q8WZ04-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific C22orf29 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific CCDC36 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific LRTOMT Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific PYROXD1 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific RBMS3 Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|