원본
Thermo Fisher Scientific LRTOMT Polyclonal Antibody
상품 한눈에 보기
LRTOMT 단백질을 표적으로 하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody입니다. Western blot 및 IHC(P) 실험에 적합하며, 인간, 마우스, 랫트 반응성을 보입니다. 고순도 친화 크로마토그래피 정제 제품으로 연구용으로만 사용됩니다.
- 카탈로그번호
- PA5114402
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 04:27
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5114402 LRTOMT Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific LRTOMT Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.5–1 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human LRTOMT (RLLTVERDPRTAAVAEKLIRLAGFDEHMVEL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884858 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Required for auditory function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지: PA5-114402_LRTOMT_Q8WZ04-1_Rabbit.svg)
(이미지: PA5-114402_LRTOMT_Q8WZ04-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific C22orf29 Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific CCDC36 Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PYROXD1 Polyclonal Antibody680,400원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific RBMS3 Polyclonal Antibody680,400원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.