
Thermo Fisher Scientific C22orf29 Polyclonal Antibody
상품 한눈에 보기
C22orf29 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 Flow cytometry에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 고순도의 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884861 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
C22orf29, located in mitochondrion, is involved in mitochondrial outer membrane permeabilization and regulation of mitochondrial membrane potential.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific KLF5 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific PUMA alpha Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific C22orf29 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific CCDC36 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific LRTOMT Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.