CacheBy
Thermo Fisher Scientific C22orf29 Polyclonal Antibody
원본

Thermo Fisher Scientific C22orf29 Polyclonal Antibody

상품 한눈에 보기

C22orf29 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot과 Flow cytometry에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 고순도의 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 연구용으로만 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 28. 오전 04:07
Thermo Fisher Scientific PA5114405 C22orf29 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원

Thermo Fisher Scientific · Thermo Fisher Scientific C22orf29 Polyclonal Antibody

Applications and Tested Dilutions

Application Tested Dilution
Western Blot (WB) 0.25–0.5 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD).
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2884861

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

C22orf29, located in mitochondrion, is involved in mitochondrial outer membrane permeabilization and regulation of mitochondrial membrane potential.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.