
Thermo Fisher Scientific NFIB Polyclonal Antibody
NFIB 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western blot 및 IHC(P) 실험에 적합합니다. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며, 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human NFIB/NF1B2 (ELVRVSRTPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQR). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746851 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
NF-1, also designated CTF, consists of a family of CCAAT box binding proteins that stimulate DNA replication and activate transcription. Analysis of human NF-1 messenger RNA has revealed two forms of the NF-1 protein arising from an alternate splicing of a single NF-1 gene. NF-1 binds its consensus DNA element as a homodimer via an amino-terminal DNA binding domain, and activates transcription through a proline-rich, carboxy terminal transactivation domain. The NF-1 protein recognizes and binds the adenovirus type 2 promoter and activates transcription of herpes simplex virus thymidine kinase genes. The NF-1 consensus element is found in the upstream promoter region of numerous eukaryotic genes, including Ha-Ras, alpha-globin, HSP70, GRP78, Histone H1, myelin basic protein, and the Xenopus laevis vitellogenin gene promoter.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Kallikrein 1 Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific IkB beta Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NFIB Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NFIA Polyclonal Antibody
568,000원

Thermo Fisher Scientific
Thermo Fisher Scientific NFATC3 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|