Thermo Fisher Scientific NFIA Polyclonal Antibody
NFIA 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체로, 인간·마우스·랫트 반응성. 연구용으로만 사용.
- 카탈로그번호
- PA579735
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific NFIA Polyclonal Antibody
Thermo Fisher Scientific NFIA Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human NFIA (180–224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746850 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
NF-1, also designated CTF, is a family of CCAAT box binding proteins that stimulate DNA replication and activate transcription. Human NF-1 mRNA analysis reveals two forms of NF-1 protein from alternative splicing of a single gene. NF-1 binds its consensus DNA element as a homodimer via an amino-terminal DNA binding domain and activates transcription through a proline-rich carboxy-terminal transactivation domain. It recognizes and binds the adenovirus type 2 promoter and activates transcription of herpes simplex virus thymidine kinase genes. The NF-1 consensus element is found in upstream promoter regions of various eukaryotic genes such as Ha-Ras, alpha-globin, HSP70, GRP78, Histone H1, myelin basic protein, and Xenopus laevis vitellogenin gene promoter.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.