Thermo Fisher Scientific NFIA Polyclonal Antibody
NFIA 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고순도 항체로, 인간·마우스·랫트 반응성. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific NFIA Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human NFIA (180–224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSGVFS) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746850 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
NF-1, also designated CTF, is a family of CCAAT box binding proteins that stimulate DNA replication and activate transcription. Human NF-1 mRNA analysis reveals two forms of NF-1 protein from alternative splicing of a single gene. NF-1 binds its consensus DNA element as a homodimer via an amino-terminal DNA binding domain and activates transcription through a proline-rich carboxy-terminal transactivation domain. It recognizes and binds the adenovirus type 2 promoter and activates transcription of herpes simplex virus thymidine kinase genes. The NF-1 consensus element is found in upstream promoter regions of various eukaryotic genes such as Ha-Ras, alpha-globin, HSP70, GRP78, Histone H1, myelin basic protein, and Xenopus laevis vitellogenin gene promoter.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific IkB beta Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NFIB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NFIA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NFATC3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific NFATC2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|