Thermo Fisher Scientific SFTPA1/SFTPA2 Polyclonal Antibody
SFTPA1/SFTPA2 단백질을 인식하는 Rabbit Polyclonal 항체로, 인간, 생쥐, 랫트에 반응합니다. Western blot 및 면역조직화학(IHC) 분석에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 후 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL | - |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2 (206–237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2747102 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Surfactant protein A (SP-A)는 폐 상피세포에 의해 합성 및 분비되며, C-type lectin 계열의 group III에 속합니다. 이 단백질은 다수의 구형(head) 구조가 삼중 나선형 콜라겐 유사 영역으로 연결된 구조를 가지며, SP-D, mannan-binding protein, conglutinin, collectin-43 등과 함께 C1q 수용체에 결합합니다. SP-A와 SP-D는 폐포 대식세포의 산소 라디칼 생성을 촉진하는 것으로 알려져 있으며, 건강한 사람의 혈청 내 농도는 약 45 ng/mL입니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SFTPC Polyclonal Antibody
514,100원
Thermo Fisher Scientific
Thermo Fisher Scientific SFTPA1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SFTPA1/SFTPA2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SF1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PAI1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|