Atlas Antibodies Anti-DVL2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human DVL2 for WB and ICC applications. Affinity purified using PrEST antigen for high specificity. Suitable for detecting dishevelled segment polarity protein 2 in human samples.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DVL2 Antibody
Target: Dishevelled segment polarity protein 2
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human DVL2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Dishevelled segment polarity protein 2 |
| Target Gene | DVL2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000017915 (95%), Mouse ENSMUSG00000020888 (91%) |
Antibody Information
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data Sheet | Material Safety Data Sheet |
Antigen Sequence
PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.