AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DVL2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody against human DVL2 protein. Validated for WB and ICC applications. High sequence identity with rat and mouse orthologs. Affinity purified for high specificity and reproducibility.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021611-100 Anti-DVL2 Antibody, dishevelled segment polarity protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021611-25 Anti-DVL2 Antibody, dishevelled segment polarity protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DVL2 Antibody
Anti-DVL2 Antibody
Target Protein: dishevelled segment polarity protein 2 (DVL2)
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human DVL2.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | dishevelled segment polarity protein 2 |
| Target Gene | DVL2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000017915 | 95% |
| Mouse | ENSMUSG00000020888 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.