CacheBy
Atlas Antibodies Anti-DVL2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DVL2 Antibody

상품 한눈에 보기

Human DVL2 단백질을 표적으로 하는 rabbit polyclonal antibody로, WB 및 ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. PBS/glycerol buffer에 sodium azide 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064732-100 Anti-DVL2 Antibody, dishevelled segment polarity protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064732-25 Anti-DVL2 Antibody, dishevelled segment polarity protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DVL2 Antibody

Anti-DVL2 Antibody

Target: Dishevelled segment polarity protein 2
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human DVL2.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Dishevelled segment polarity protein 2
Target Gene DVL2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVP
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000017915 (95%), Mouse ENSMUSG00000020888 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야별 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.