CacheBy
Atlas Antibodies Anti-DTX3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DTX3 Antibody

상품 한눈에 보기

Human DTX3 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 유사성을 보입니다. PBS/glycerol buffer에 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059654-100 Anti-DTX3 Antibody, deltex 3, E3 ubiquitin ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059654-25 Anti-DTX3 Antibody, deltex 3, E3 ubiquitin ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DTX3 Antibody

Anti-DTX3 Antibody

Target: deltex 3, E3 ubiquitin ligase
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DTX3.

Alternative Gene Names

FLJ34766, RNF154

Open Datasheet

Target Information

항목 내용
Target Protein deltex 3, E3 ubiquitin ligase
Target Gene DTX3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LPPRLREEAEEQESTCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMC

Species Reactivity

  • Verified: Human
  • Highest antigen sequence identity:
    • Rat (ENSRNOG00000005129) – 96%
    • Mouse (ENSMUSG00000040415) – 96%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.