CacheBy
Atlas Antibodies Anti-DTX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DTX1 Antibody

상품 한눈에 보기

Human DTX1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 정교한 직교 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공. Human, Rat, Mouse에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055275-100 Anti-DTX1 Antibody, deltex 1, E3 ubiquitin ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055275-25 Anti-DTX1 Antibody, deltex 1, E3 ubiquitin ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DTX1 Antibody

Anti-DTX1 Antibody

Target: deltex 1, E3 ubiquitin ligase

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human DTX1

Alternative Gene Names

hDx-1

Open Datasheet

Target Information

항목 내용
Target Protein deltex 1, E3 ubiquitin ligase
Target Gene DTX1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence PPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPP
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000050848 (100%), Mouse ENSMUSG00000029603 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.