CacheBy
Atlas Antibodies Anti-DTX4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DTX4 Antibody

상품 한눈에 보기

Human DTX4 단백질을 인식하는 토끼 폴리클로날 항체로, deltex 4 E3 유비퀴틴 리가아제 연구에 적합합니다. IHC 등 다양한 응용에 사용 가능하며, 고순도의 Affinity 정제 항체입니다. PBS와 글리세롤 기반 버퍼에 보존제를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056760-100 Anti-DTX4 Antibody, deltex 4, E3 ubiquitin ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056760-25 Anti-DTX4 Antibody, deltex 4, E3 ubiquitin ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DTX4 Antibody

Anti-DTX4 Antibody

Target: deltex 4, E3 ubiquitin ligase (DTX4)
Type: Polyclonal Antibody against Human DTX4


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human DTX4 (deltex 4, E3 ubiquitin ligase).


Alternative Gene Names

  • KIAA0937
  • RNF155

Open Datasheet


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    TSPPMSPCSCPQCVLVMSVKAAVVNGSTGPLQLPVTRKNMPPPGVVKLP

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Identity
Rat ENSRNOG00000021086 73%
Mouse ENSMUSG00000039982 71%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.