CacheBy
Atlas Antibodies Anti-SHOC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SHOC2 Antibody

상품 한눈에 보기

Human SHOC2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. 높은 종간 반응성(인간, 마우스, 랫드)과 높은 특이성을 가지며, PrEST 항원을 이용해 친화 정제되었습니다. 연구용으로 안정적인 저장이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048134-100 Anti-SHOC2 Antibody, SHOC2, leucine rich repeat scaffold protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048134-25 Anti-SHOC2 Antibody, SHOC2, leucine rich repeat scaffold protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SHOC2 Antibody

Anti-SHOC2 Antibody

soc-2 suppressor of clear homolog (C. elegans)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SHOC2.

Alternative Gene Names

KIAA0862, SOC-2, SOC2, SUR-8, SUR8

Open Datasheet

Target Information

항목 내용
Target Protein soc-2 suppressor of clear homolog (C. elegans)
Target Gene SHOC2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000015339 (100%), Mouse ENSMUSG00000024976 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.