CacheBy
Atlas Antibodies Anti-SHOC2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SHOC2 Antibody

상품 한눈에 보기

Human SHOC2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009164-100 Anti-SHOC2 Antibody, soc-2 suppressor of clear homolog (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009164-25 Anti-SHOC2 Antibody, soc-2 suppressor of clear homolog (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SHOC2 Antibody

Anti-SHOC2 Antibody

Target: soc-2 suppressor of clear homolog (C. elegans)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human SHOC2.

Alternative Gene Names

KIAA0862, SOC-2, SOC2, SUR-8, SUR8

Open Datasheet

Target Information

항목 내용
Target Protein soc-2 suppressor of clear homolog (C. elegans)
Target Gene SHOC2
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRGIGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYLNDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQIVA

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

유전자 ID 항원 서열 일치율
Rat ENSRNOG00000015339 100%
Mouse ENSMUSG00000024976 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.