Atlas Antibodies Anti-SHPRH Antibody
| 상품 옵션 정보 | |||||||
|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA034854-100 | Atlas Antibodies HPA034854-100 Anti-SHPRH Antibody, SNF2 histone linker PHD RING helicase, E3 ubiquitin protein ligase 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA034854-25 | Atlas Antibodies HPA034854-25 Anti-SHPRH Antibody, SNF2 histone linker PHD RING helicase, E3 ubiquitin protein ligase 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-SHPRH Antibody
SNF2 histone linker PHD RING helicase, E3 ubiquitin protein ligase
Recommended Applications
Product Description
Polyclonal Antibody against Human SHPRH
Alternative Gene Names
bA545I5.2, FLJ90837, KIAA2023
Target Protein
SNF2 histone linker PHD RING helicase, E3 ubiquitin protein ligase
Target Gene
SHPRH
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KKNPQHLYSFIAKILWRSAKKDVIDQIQIPPQTEEIHWLHFSPVERHFYHRQHEVCCQDVVVKLRKISDWALKLSSLDRRTVTSILYPLL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000014450 (96%)
Mouse ENSMUSG00000090112 (94%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|