
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SHARPIN Antibody
상품 한눈에 보기
인간 SHARPIN 단백질에 대한 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다. Rabbit IgG 형식으로, glycerol/PBS 버퍼에 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044453-100 Anti-SHARPIN Antibody, SHANK-associated RH domain interactor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044453-25 Anti-SHARPIN Antibody, SHANK-associated RH domain interactor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SHARPIN Antibody
Anti-SHARPIN Antibody
SHANK-associated RH domain interactor
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation:
Protein expression verified using WB compared to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human SHARPIN
Alternative Gene Names
- DKFZP434N1923
- SIPL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SHANK-associated RH domain interactor |
| Target Gene | SHARPIN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLARAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPG |
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000022552 (62%)
- Rat ENSRNOG00000012812 (57%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



