Atlas Antibodies Anti-SHANK1 Antibody

상품 한눈에 보기

Human SHANK1 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC에 적합합니다. Orthogonal validation으로 단백질 발현을 검증하였으며, 고순도의 Affinity purification 방식으로 제작되었습니다. SH3 및 multiple ankyrin repeat domains 연구용에 적합합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032130-100 Anti-SHANK1 Antibody, SH3 and multiple ankyrin repeat domains 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032130-25 Anti-SHANK1 Antibody, SH3 and multiple ankyrin repeat domains 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SHANK1 Antibody

Anti-SHANK1 Antibody

Target: SH3 and multiple ankyrin repeat domains 1 (SHANK1)
Type: Polyclonal Antibody against Human SHANK1

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal antibody raised in rabbit against human SHANK1.

Alternative Gene Names

SPANK-1, SSTRIP, synamon

Open Datasheet (PDF)

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
TVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQNWPKPPLP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000019207	91%
Mouse	ENSMUSG00000038738	90%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand