AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SHB Antibody
상품 한눈에 보기
Human SHB 단백질에 대한 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 완충액에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052108-100 Anti-SHB Antibody, Src homology 2 domain containing adaptor protein B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052108-25 Anti-SHB Antibody, Src homology 2 domain containing adaptor protein B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SHB Antibody
Anti-SHB Antibody
Target: Src homology 2 domain containing adaptor protein B (SHB)
Type: Polyclonal Antibody against Human SHB
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody targeting the human SHB protein.
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Src homology 2 domain containing adaptor protein B |
| Target Gene | SHB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000011503 (89%), Mouse ENSMUSG00000044813 (86%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.