Atlas Antibodies Anti-SHANK1 Antibody

상품 한눈에 보기

Human SHANK1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Orthogonal validation을 통해 단백질 발현이 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 대한 반응성이 검증되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA032129-100 Anti-SHANK1 Antibody, SH3 and multiple ankyrin repeat domains 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA032129-25 Anti-SHANK1 Antibody, SH3 and multiple ankyrin repeat domains 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SHANK1 Antibody

Anti-SHANK1 Antibody

Target: SH3 and multiple ankyrin repeat domains 1 (SHANK1)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot) — Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human SHANK1.

Alternative Gene Names

SPANK-1, SSTRIP, synamon

Target Information

항목	내용
Target Protein	SH3 and multiple ankyrin repeat domains 1
Target Gene	SHANK1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (aa)	TVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGGGDSHHGGASYVPERTSSLQRQRLSDDSQSSLLSKPVSSLFQNWPKPPLP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000019207 (91%)
Mouse ENSMUSG00000038738 (90%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand