
Atlas Antibodies Anti-SF3A3 Antibody
상품 한눈에 보기
Human SF3A3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화정제 방식으로 제조되었으며, 사람, 생쥐, 랫드에 반응합니다. 스플라이싱 인자 연구용으로 권장됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SF3A3 Antibody
Target: splicing factor 3a, subunit 3, 60kDa
Type: Polyclonal Antibody against Human SF3A3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody targeting human SF3A3 (splicing factor 3a, subunit 3, 60kDa).
Alternative Gene Names
PRP9, PRPF9, SAP61, SF3a60
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | splicing factor 3a, subunit 3, 60kDa |
| Target Gene | SF3A3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TKKSTLRDQINSDHRTRAMQDRYMEVSGNLRDLYDDKDGLRKEELNAISGPNEFAEFYNRLKQIKEFHRKHPNEICVPMSVEFE |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000007629 (100%)
- Mouse ENSMUSG00000028902 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SF3B2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SF3A2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SF3A3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SF3B1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SF3A1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.