CacheBy
Atlas Antibodies Anti-SF3A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SF3A2 Antibody

상품 한눈에 보기

인간 SF3A2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. 토끼 유래 IgG 형식이며 PrEST 항원을 사용한 친화 정제 방식. 높은 종 간 보존성과 신뢰성 있는 단백질 발현 검증 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049439-100 Anti-SF3A2 Antibody, splicing factor 3a, subunit 2, 66kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049439-25 Anti-SF3A2 Antibody, splicing factor 3a, subunit 2, 66kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SF3A2 Antibody

Anti-SF3A2 Antibody

Target: splicing factor 3a, subunit 2, 66kDa
Type: Polyclonal Antibody against Human SF3A2


  • IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Independent Validation): Validation of protein expression in western blot by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against human SF3A2.


Alternative Gene Names

Prp11, PRPF11, SAP62, SF3a66

Open Datasheet


Target Information

항목 내용
Target Protein splicing factor 3a, subunit 2, 66kDa
Target Gene SF3A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP
Verified Species Reactivity Human
Interspecies Identity Mouse (99%), Rat (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.