Atlas Antibodies Anti-SF3A2 Antibody

상품 한눈에 보기

인간 SF3A2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. 토끼 유래 IgG 형식이며 PrEST 항원을 사용한 친화 정제 방식. 높은 종 간 보존성과 신뢰성 있는 단백질 발현 검증 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049439-100 Anti-SF3A2 Antibody, splicing factor 3a, subunit 2, 66kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049439-25 Anti-SF3A2 Antibody, splicing factor 3a, subunit 2, 66kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: splicing factor 3a, subunit 2, 66kDa
Type: Polyclonal Antibody against Human SF3A2

IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in western blot by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human SF3A2.

Prp11, PRPF11, SAP62, SF3a66

항목	내용
Target Protein	splicing factor 3a, subunit 2, 66kDa
Target Gene	SF3A2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	EVKKFVKIGRPGYKVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP
Verified Species Reactivity	Human
Interspecies Identity	Mouse (99%), Rat (98%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
Safety Data Sheet	Material Safety Data Sheet