Atlas Antibodies Anti-SF3A1 Antibody

상품 한눈에 보기

Human SF3A1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 유전학적 검증으로 신뢰성 확보. Rabbit 유래 IgG로 PrEST 항원 친화 정제. Human, Mouse, Rat 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA000690-100 Anti-SF3A1 Antibody, splicing factor 3a, subunit 1, 120kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA000690-25 Anti-SF3A1 Antibody, splicing factor 3a, subunit 1, 120kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: splicing factor 3a, subunit 1, 120kDa
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Genetic validation by siRNA knockdown.
ICC (Immunocytochemistry): Validated for cellular localization studies.

Polyclonal antibody against Human SF3A1.

Prp21, PRPF21, SAP114, SF3a120

항목	내용
Target Protein	splicing factor 3a, subunit 1, 120kDa
Target Gene	SF3A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK

Human, Mouse, Rat

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000002129	97%
Rat	ENSRNOG00000005218	97%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand