
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SF3A1 Antibody
상품 한눈에 보기
Human SF3A1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 유전학적 검증으로 신뢰성 확보. Rabbit 유래 IgG로 PrEST 항원 친화 정제. Human, Mouse, Rat 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA000690-100 Anti-SF3A1 Antibody, splicing factor 3a, subunit 1, 120kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000690-25 Anti-SF3A1 Antibody, splicing factor 3a, subunit 1, 120kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SF3A1 Antibody
Anti-SF3A1 Antibody
Target: splicing factor 3a, subunit 1, 120kDa
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Genetic validation by siRNA knockdown.
- ICC (Immunocytochemistry): Validated for cellular localization studies.
Product Description
Polyclonal antibody against Human SF3A1.
Alternative Gene Names
Prp21, PRPF21, SAP114, SF3a120
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | splicing factor 3a, subunit 1, 120kDa |
| Target Gene | SF3A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000002129 | 97% |
| Rat | ENSRNOG00000005218 | 97% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



