CacheBy
Atlas Antibodies Anti-SF3A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SF3A1 Antibody

상품 한눈에 보기

Human SF3A1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 및 유전학적 검증으로 신뢰성 확보. Rabbit 유래 IgG로 PrEST 항원 친화 정제. Human, Mouse, Rat 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000690-100 Anti-SF3A1 Antibody, splicing factor 3a, subunit 1, 120kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000690-25 Anti-SF3A1 Antibody, splicing factor 3a, subunit 1, 120kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SF3A1 Antibody

Anti-SF3A1 Antibody

Target: splicing factor 3a, subunit 1, 120kDa
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot): Genetic validation by siRNA knockdown.
  • ICC (Immunocytochemistry): Validated for cellular localization studies.

Product Description

Polyclonal antibody against Human SF3A1.


Alternative Gene Names

Prp21, PRPF21, SAP114, SF3a120

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein splicing factor 3a, subunit 1, 120kDa
Target Gene SF3A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TEDSLMPEEEFLRRNKGPVSIKVQVPNMQDKTEWKLNGQVLVFTLPLTDQVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAVIHLALKESGGRKK

Verified Species Reactivity

Human, Mouse, Rat


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000002129 97%
Rat ENSRNOG00000005218 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.