Atlas Antibodies Anti-SEZ6 Antibody

상품 한눈에 보기

Human SEZ6 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 확인함. Affinity 정제 방식으로 높은 특이성과 재현성을 제공하며, Human, Mouse, Rat 종에 반응. 연구용으로 SEZ6 발현 분석에 적합.

카탈로그번호: HPA011777-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA011777-100 Anti-SEZ6 Antibody, seizure related 6 homolog (mouse) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA011777-25 Anti-SEZ6 Antibody, seizure related 6 homolog (mouse) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SEZ6 Antibody

Anti-SEZ6 Antibody

Target: Seizure related 6 homolog (mouse)
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human SEZ6.

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	Seizure related 6 homolog (mouse)
Target Gene	SEZ6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (96%), Rat (96%)

Antigen Sequence:
PGDVEHSRRLISSPKFPVGATVQYICDQGFVLMGSSILTCHDRQAGSPKWSDRAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQASIKCVPGHPSHWSDPPPICRA

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand