CacheBy
Atlas Antibodies Anti-SEZ6L Antibody
원본

Atlas Antibodies Anti-SEZ6L Antibody

상품 한눈에 보기

Human SEZ6L 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

카탈로그번호
HPA045135-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045135-100 Anti-SEZ6L Antibody, seizure related 6 homolog like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045135-25 Anti-SEZ6L Antibody, seizure related 6 homolog like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEZ6L Antibody

Anti-SEZ6L Antibody

Target Information

  • Target Protein: Seizure related 6 homolog like
  • Target Gene: SEZ6L
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDT

Product Description

Polyclonal Antibody against Human SEZ6L

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000025612 (96%)
  • Mouse ENSMUSG00000058153 (96%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

면역세포화학 (ICC)

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.