CacheBy
Atlas Antibodies Anti-SEZ6L Antibody
원본

Atlas Antibodies Anti-SEZ6L Antibody

상품 한눈에 보기

Human SEZ6L 단백질을 인식하는 Rabbit Polyclonal 항체로, 면역세포화학(ICC) 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045135-100 Anti-SEZ6L Antibody, seizure related 6 homolog like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045135-25 Anti-SEZ6L Antibody, seizure related 6 homolog like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEZ6L Antibody

Anti-SEZ6L Antibody

Target Information

  • Target Protein: Seizure related 6 homolog like
  • Target Gene: SEZ6L
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
QFLNLSNSDILTIYDGDEVMPHILGQYLGNSGPQKLYSSTPDLTIQFHSDPAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDT

Product Description

Polyclonal Antibody against Human SEZ6L

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000025612 (96%)
  • Mouse ENSMUSG00000058153 (96%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

면역세포화학 (ICC)

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.