CacheBy
Atlas Antibodies Anti-SEZ6L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SEZ6L2 Antibody

상품 한눈에 보기

Human SEZ6L2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정합 검증(Orthogonal validation)을 통해 확인됨. Affinity 정제 방식으로 높은 특이성과 재현성을 제공하며, 인간 샘플 분석에 적합. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064471-100 Anti-SEZ6L2 Antibody, seizure related 6 homolog (mouse)-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064471-25 Anti-SEZ6L2 Antibody, seizure related 6 homolog (mouse)-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SEZ6L2 Antibody

Anti-SEZ6L2 Antibody

Target: seizure related 6 homolog (mouse)-like 2 (SEZ6L2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against Human SEZ6L2.
Validated by orthogonal comparison of protein expression using IHC and RNA-seq data.


Alternative Gene Names

  • FLJ90517
  • PSK-1

Target Information

항목 내용
Target Protein seizure related 6 homolog (mouse)-like 2
Target Gene SEZ6L2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000027098 (99%), Mouse ENSMUSG00000030683 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Additional Information

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.