Atlas Antibodies Anti-SEZ6L2 Antibody

상품 한눈에 보기

Human SEZ6L2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정합 검증(Orthogonal validation)을 통해 확인됨. Affinity 정제 방식으로 높은 특이성과 재현성을 제공하며, 인간 샘플 분석에 적합. 40% 글리세롤 및 PBS 완충액에 보존.

카탈로그번호: HPA064471-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA064471-100 Anti-SEZ6L2 Antibody, seizure related 6 homolog (mouse)-like 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA064471-25 Anti-SEZ6L2 Antibody, seizure related 6 homolog (mouse)-like 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SEZ6L2 Antibody

Anti-SEZ6L2 Antibody

Target: seizure related 6 homolog (mouse)-like 2 (SEZ6L2)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against Human SEZ6L2.
Validated by orthogonal comparison of protein expression using IHC and RNA-seq data.

Alternative Gene Names

FLJ90517
PSK-1

Target Information

항목	내용
Target Protein	seizure related 6 homolog (mouse)-like 2
Target Gene	SEZ6L2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000027098 (99%), Mouse ENSMUSG00000030683 (96%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분	내용
Buffer	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide
MSDS	Material Safety Data Sheet

Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Recommended Applications

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.