
Atlas Antibodies Anti-SCRN2 Antibody
Human SCRN2 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Recombinant Expression 검증 완료. Affinity purification 방식으로 높은 특이성과 안정성 제공.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SCRN2 Antibody
Target Protein: secernin 2
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.ICC (Immunocytochemistry)
Suitable for ICC applications.
Product Description
Polyclonal antibody against Human SCRN2.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | secernin 2 |
| Target Gene | SCRN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence (Full) | LSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000020877 (83%), Rat ENSRNOG00000010214 (80%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SCRIB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCRN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCRN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCRIB Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|