Atlas Antibodies Anti-SCRN2 Antibody

상품 한눈에 보기

Human SCRN2 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal 및 Recombinant Expression 검증 완료. Affinity purification 방식으로 높은 특이성과 안정성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023434-100 Anti-SCRN2 Antibody, secernin 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023434-25 Anti-SCRN2 Antibody, secernin 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: secernin 2
Supplier: Atlas Antibodies

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
ICC (Immunocytochemistry)
Suitable for ICC applications.

Polyclonal antibody against Human SCRN2.

항목	내용
Target Protein	secernin 2
Target Gene	SCRN2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence (Full)	LSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDS
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000020877 (83%), Rat ENSRNOG00000010214 (80%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.