CacheBy
Atlas Antibodies Anti-SCRIB Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCRIB Antibody

상품 한눈에 보기

Human SCRIB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. 40% 글리세롤 PBS 용액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA064312-100 Anti-SCRIB Antibody, scribbled planar cell polarity protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064312-25 Anti-SCRIB Antibody, scribbled planar cell polarity protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCRIB Antibody

Anti-SCRIB Antibody

scribbled planar cell polarity protein


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human SCRIB


Alternative Gene Names

KIAA0147, SCRB1, Vartul

Open Datasheet


Target Information

항목 내용
Target Protein scribbled planar cell polarity protein
Target Gene SCRIB
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022568 (75%), Rat ENSRNOG00000032574 (74%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.