
Atlas Antibodies Anti-SCRIB Antibody
상품 한눈에 보기
Human SCRIB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 정제되었으며, RNA-seq 데이터 기반 Orthogonal 검증 완료. 40% 글리세롤 PBS 용액에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SCRIB Antibody
scribbled planar cell polarity protein
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human SCRIB
Alternative Gene Names
KIAA0147, SCRB1, Vartul
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | scribbled planar cell polarity protein |
| Target Gene | SCRIB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000022568 (75%), Rat ENSRNOG00000032574 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SCRN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCRG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCRIB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCOC Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCPEP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.