Atlas Antibodies Anti-SCRIB Antibody

상품 한눈에 보기

인간 SCRIB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 사용해 높은 특이성과 재현성을 제공합니다. RNA-seq 데이터 기반 Orthogonal 검증으로 신뢰성 향상.

카탈로그번호: HPA023557-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023557-100 Anti-SCRIB Antibody, scribbled planar cell polarity protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023557-25 Anti-SCRIB Antibody, scribbled planar cell polarity protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SCRIB Antibody

Anti-SCRIB Antibody

Target: scribbled planar cell polarity protein
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal validation)
ICC (Immunocytochemistry)

Orthogonal validation:
Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human SCRIB

Alternative Gene Names

KIAA0147, SCRB1, Vartul

Open Datasheet

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VSVIQFLEAPIGDEDAEEAAAEKRGLQRRATPHPSELKVMKRSIEGRRSEACPCQPDSGSPLPAEEEKRLSAESGLSEDSRPSASTVS

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

Mouse (ENSMUSG00000022568): 75%
Rat (ENSRNOG00000032574): 74%

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand