Atlas Antibodies Anti-SCPEP1 Antibody

상품 한눈에 보기

인간 SCPEP1 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간, 마우스, 랫트에 반응하며, 40% 글리세롤과 PBS 완충액에 보존되어 있습니다.

카탈로그번호: HPA057200-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057200-100 Anti-SCPEP1 Antibody, serine carboxypeptidase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057200-25 Anti-SCPEP1 Antibody, serine carboxypeptidase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-SCPEP1 Antibody

Anti-SCPEP1 Antibody

Target Protein: Serine carboxypeptidase 1
Product Type: Polyclonal Antibody against Human SCPEP1

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

This polyclonal antibody targets the human SCPEP1 (serine carboxypeptidase 1) protein. It is affinity purified using the PrEST antigen as the affinity ligand.

Alternative Gene Names

RISC

Open Datasheet (PDF)

Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KPVISIVDELLEAGINVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKNLAFYWILKAGHMVPSDQGDMALKMMRLVTQQ

Species Reactivity

Human
Mouse
Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000002358 (85%)
Mouse ENSMUSG00000000278 (82%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method	Affinity purified using PrEST antigen
Preservative	0.02% Sodium azide (Material Safety Data Sheet)