CacheBy
Atlas Antibodies Anti-SCO1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCO1 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-SCO1 항체는 인간 SCO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립적 검증을 거쳤습니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 확인된 고품질 연구용 항체입니다.

카탈로그번호
HPA021579-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021579-100 Anti-SCO1 Antibody, SCO1 cytochrome c oxidase assembly protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021579-25 Anti-SCO1 Antibody, SCO1 cytochrome c oxidase assembly protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCO1 Antibody

Anti-SCO1 Antibody

SCO1 cytochrome c oxidase assembly protein

  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human SCO1

Alternative Gene Names

SCOD1

Open Datasheet


Target Information

항목 내용
Target Protein SCO1 cytochrome c oxidase assembly protein
Target Gene SCO1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000069844 (86%), Rat ENSRNOG00000028699 (86%)

Antigen Sequence:

TREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.