CacheBy
Atlas Antibodies Anti-SCOC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCOC Antibody

상품 한눈에 보기

Human SCOC 단백질을 인식하는 Rabbit Polyclonal Antibody로, Affinity purification 방식으로 정제됨. 다양한 응용 분야에 적합하며, 높은 종간 반응성(인간, 생쥐, 랫트 100%)을 보임. 안정적인 PBS/glycerol buffer에 보존됨.

카탈로그번호
HPA061198-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061198-100 Anti-SCOC Antibody, short coiled-coil protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061198-25 Anti-SCOC Antibody, short coiled-coil protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCOC Antibody

Anti-SCOC Antibody

Target: Short coiled-coil protein (SCOC)
Supplier: Atlas Antibodies

Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human SCOC

Alternative Gene Names

HRIHFB2072, SCOCO

Open Datasheet (PDF)

Target Information

  • Target Protein: Short coiled-coil protein
  • Target Gene: SCOC
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ADMDAVDAENQVELEEKTRLINQVLELQHTLEDLSARVDAVKEENLKLKSENQVLGQYIENLMSASSV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000003853 (100%)
  • Mouse ENSMUSG00000063253 (100%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.