CacheBy
Atlas Antibodies Anti-SCO2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCO2 Antibody

상품 한눈에 보기

Human SCO2 단백질에 대한 폴리클로날 항체로, 미토콘드리아 cytochrome c oxidase 조립 단백질 연구에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. ICC 등 다양한 응용에 사용 가능.

카탈로그번호
HPA056254-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056254-100 Anti-SCO2 Antibody, SCO2, cytochrome c oxidase assembly protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056254-25 Anti-SCO2 Antibody, SCO2, cytochrome c oxidase assembly protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCO2 Antibody

Anti-SCO2 Antibody

Target: SCO2, cytochrome c oxidase assembly protein
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human SCO2, a cytochrome c oxidase assembly protein.


Alternative Gene Names

  • MYP6
  • SCO1L

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein SCO2, cytochrome c oxidase assembly protein
Target Gene SCO2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRG
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000091780 (65%), Rat ENSRNOG00000006784 (26%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.