Atlas Antibodies Anti-SCO1 Antibody

상품 한눈에 보기

Human SCO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 비교를 통한 단백질 발현 검증에 사용. Rabbit 유래 IgG이며 PrEST 항원으로 정제됨. Human에 반응하며 Mouse, Rat과 86% 서열 동일성.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021565-100 Anti-SCO1 Antibody, SCO1 cytochrome c oxidase assembly protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021565-25 Anti-SCO1 Antibody, SCO1 cytochrome c oxidase assembly protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

SCO1 cytochrome c oxidase assembly protein

IHC Independent Validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human SCO1

항목	내용
Target Protein	SCO1 cytochrome c oxidase assembly protein
Target Gene	SCO1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	TREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000069844 (86%), Rat ENSRNOG00000028699 (86%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand