
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SCO1 Antibody
상품 한눈에 보기
Human SCO1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 독립 항체 비교를 통한 단백질 발현 검증에 사용. Rabbit 유래 IgG이며 PrEST 항원으로 정제됨. Human에 반응하며 Mouse, Rat과 86% 서열 동일성.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA021565-100 Anti-SCO1 Antibody, SCO1 cytochrome c oxidase assembly protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021565-25 Anti-SCO1 Antibody, SCO1 cytochrome c oxidase assembly protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SCO1 Antibody
Anti-SCO1 Antibody
SCO1 cytochrome c oxidase assembly protein
Recommended Applications
- IHC Independent Validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human SCO1
Alternative Gene Names
- SCOD1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | SCO1 cytochrome c oxidase assembly protein |
| Target Gene | SCO1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TREEVDQVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKRKGEIAASIATHMRPYR |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000069844 (86%), Rat ENSRNOG00000028699 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



