
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SCNN1G Antibody
상품 한눈에 보기
Human SCNN1G 단백질을 인식하는 폴리클로날 항체로, ENaCgamma로도 알려진 나트륨 채널 감마 서브유닛 검출에 적합. Rabbit 유래 IgG 항체이며, Affinity purification 방식으로 정제됨. Human 시료에서 검증됨.
- 카탈로그번호
- HPA071194-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071194-100 Anti-SCNN1G Antibody, sodium channel, non voltage gated 1 gamma subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071194-25 Anti-SCNN1G Antibody, sodium channel, non voltage gated 1 gamma subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SCNN1G Antibody
Anti-SCNN1G Antibody
Target: Sodium channel, non-voltage gated 1 gamma subunit (SCNN1G)
Type: Polyclonal Antibody against Human SCNN1G
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting the human SCNN1G (ENaCgamma, SCNEG) protein.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Sodium channel, non voltage gated 1 gamma subunit |
| Target Gene | SCNN1G |
| Alternative Gene Names | ENaCgamma, SCNEG |
| Antigen Sequence | SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Mouse Ortholog | ENSMUSG00000000216 (90%) |
| Rat Ortholog | ENSRNOG00000017842 (90%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



