
Atlas Antibodies Anti-SCNN1G Antibody
상품 한눈에 보기
Human SCNN1G 단백질을 인식하는 폴리클로날 항체로, ENaCgamma로도 알려진 나트륨 채널 감마 서브유닛 검출에 적합. Rabbit 유래 IgG 항체이며, Affinity purification 방식으로 정제됨. Human 시료에서 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-SCNN1G Antibody
Target: Sodium channel, non-voltage gated 1 gamma subunit (SCNN1G)
Type: Polyclonal Antibody against Human SCNN1G
Recommended Applications
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody targeting the human SCNN1G (ENaCgamma, SCNEG) protein.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Sodium channel, non voltage gated 1 gamma subunit |
| Target Gene | SCNN1G |
| Alternative Gene Names | ENaCgamma, SCNEG |
| Antigen Sequence | SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Mouse Ortholog | ENSMUSG00000000216 (90%) |
| Rat Ortholog | ENSRNOG00000017842 (90%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-SCO2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCNN1G Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCNN1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-SCNN1D Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.