CacheBy
Atlas Antibodies Anti-SCNN1G Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SCNN1G Antibody

상품 한눈에 보기

Human SCNN1G 단백질을 인식하는 폴리클로날 항체로, ENaCgamma로도 알려진 나트륨 채널 감마 서브유닛 검출에 적합. Rabbit 유래 IgG 항체이며, Affinity purification 방식으로 정제됨. Human 시료에서 검증됨.

카탈로그번호
HPA071194-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA071194-100 Anti-SCNN1G Antibody, sodium channel, non voltage gated 1 gamma subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071194-25 Anti-SCNN1G Antibody, sodium channel, non voltage gated 1 gamma subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SCNN1G Antibody

Anti-SCNN1G Antibody

Target: Sodium channel, non-voltage gated 1 gamma subunit (SCNN1G)
Type: Polyclonal Antibody against Human SCNN1G


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody targeting the human SCNN1G (ENaCgamma, SCNEG) protein.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Sodium channel, non voltage gated 1 gamma subunit
Target Gene SCNN1G
Alternative Gene Names ENaCgamma, SCNEG
Antigen Sequence SEYGLQVILYINEEEYNPFLVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQ

Species Reactivity

항목 내용
Verified Species Human
Mouse Ortholog ENSMUSG00000000216 (90%)
Rat Ortholog ENSRNOG00000017842 (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.