Thermo Fisher Scientific FGF9 Polyclonal Antibody
FGF9 단백질을 인식하는 토끼 폴리클로날 항체로, 인간·생쥐·랫드 반응성. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제됨. PBS 및 trehalose 완충액에 보관하며 -20°C 저장. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FGF9 Polyclonal Antibody
Thermo Fisher Scientific FGF9 Polyclonal Antibody
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746376 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in various biological processes, including:
- Embryonic development
- Cell growth and morphogenesis
- Tissue repair
- Tumor growth and invasion
FGF9 is secreted as a growth-stimulating factor for cultured glial cells. In the nervous system, it is produced mainly by neurons and may play a key role in glial cell development. Expression of the mouse homolog is dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene exhibit male-to-female sex reversal, suggesting a role in testicular embryogenesis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.