Thermo Fisher Scientific Fumarase Polyclonal Antibody
인간, 마우스, 랫트 반응성의 Fumarase 폴리클로날 항체. WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 형태. PBS 및 트레할로스 함유, -20°C 보관. 연구용 전용 제품.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Fumarase Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746381 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The fumarase (FH) protein is an enzymatic component of the tricarboxylic acid (Krebs) cycle, catalyzing the conversion of fumarate to L-malate. It exists in both cytosolic and mitochondrial forms, differing by the translation start site. The mitochondrial form includes an N-terminal extension that is cleaved after import. FH functions as a homotetramer and shares similarity with thermostable class II fumarases. Mutations in this gene can cause fumarase deficiency, leading to progressive encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.