Thermo Fisher Scientific Fumarase Polyclonal Antibody
인간, 마우스, 랫트 반응성의 Fumarase 폴리클로날 항체. WB, IHC, ICC, Flow Cytometry 등 다양한 응용에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 형태. PBS 및 트레할로스 함유, -20°C 보관. 연구용 전용 제품.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC-P) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC-F) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human FH (YDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746381 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The fumarase (FH) protein is an enzymatic component of the tricarboxylic acid (Krebs) cycle, catalyzing the conversion of fumarate to L-malate. It exists in both cytosolic and mitochondrial forms, differing by the translation start site. The mitochondrial form includes an N-terminal extension that is cleaved after import. FH functions as a homotetramer and shares similarity with thermostable class II fumarases. Mutations in this gene can cause fumarase deficiency, leading to progressive encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FGF9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FGF9 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Fumarase Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FGFR3 Polyclonal Antibody
621,000원
Thermo Fisher Scientific
Thermo Fisher Scientific FGF8 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|