
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DLG3 Antibody
상품 한눈에 보기
휴먼 DLG3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증을 거쳤으며, 토끼 유래 IgG 형식으로 제작되었습니다. 고순도의 Affinity 정제 방식과 안정화 버퍼로 높은 재현성과 신뢰성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001733-100 Anti-DLG3 Antibody, discs, large homolog 3 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001733-25 Anti-DLG3 Antibody, discs, large homolog 3 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DLG3 Antibody
Anti-DLG3 Antibody
Target: discs, large homolog 3 (Drosophila)
Type: Polyclonal Antibody against Human DLG3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody raised in rabbit against Human DLG3. Validated for use in IHC and WB applications.
Alternative Gene Names
KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | discs, large homolog 3 (Drosophila) |
| Target Gene | DLG3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000002767 (98%), Mouse ENSMUSG00000000881 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



