Atlas Antibodies Anti-DLG3 Antibody
상품 한눈에 보기
휴먼 DLG3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증을 거쳤으며, 토끼 유래 IgG 형식으로 제작되었습니다. 고순도의 Affinity 정제 방식과 안정화 버퍼로 높은 재현성과 신뢰성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DLG3 Antibody
Target: discs, large homolog 3 (Drosophila)
Type: Polyclonal Antibody against Human DLG3
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant expression validation using target protein overexpression
Product Description
Polyclonal antibody raised in rabbit against Human DLG3. Validated for use in IHC and WB applications.
Alternative Gene Names
KIAA1232, MRX90, NE-Dlg, NEDLG, PPP1R82, SAP-102, SAP102
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | discs, large homolog 3 (Drosophila) |
| Target Gene | DLG3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000002767 (98%), Mouse ENSMUSG00000000881 (98%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.