CacheBy
Atlas Antibodies Anti-DLG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLG2 Antibody

상품 한눈에 보기

Human DLG2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. 고순도 Affinity purified 제품으로 높은 특이성과 재현성을 제공. Human 시료에 최적화된 연구용 항체.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023896-100 Anti-DLG2 Antibody, discs, large homolog 2 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023896-25 Anti-DLG2 Antibody, discs, large homolog 2 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLG2 Antibody

Anti-DLG2 Antibody

Target: discs, large homolog 2 (Drosophila)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human DLG2


Alternative Gene Names

  • chapsyn-110
  • PPP1R58
  • PSD-93
  • PSD93

Open Datasheet


Antigen Information

Target Protein: discs, large homolog 2 (Drosophila)
Target Gene: DLG2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000022635 99%
Mouse ENSMUSG00000052572 98%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.