CacheBy
Atlas Antibodies Anti-DLG2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DLG2 Antibody

상품 한눈에 보기

Human DLG2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 분석에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었습니다. 고순도 Affinity 정제 방식으로 제조되었으며, Human에 대한 높은 특이성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021307-100 Anti-DLG2 Antibody, discs, large homolog 2 (Drosophila) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021307-25 Anti-DLG2 Antibody, discs, large homolog 2 (Drosophila) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DLG2 Antibody

Anti-DLG2 Antibody

discs, large homolog 2 (Drosophila)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human DLG2

Alternative Gene Names

chapsyn-110, PPP1R58, PSD-93, PSD93

Open Datasheet

Target Information

항목 내용
Target Protein discs, large homolog 2 (Drosophila)
Target Gene DLG2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPPEPVYSTVNKLCDKP
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000022635 (99%), Mouse ENSMUSG00000052572 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.