CacheBy
Atlas Antibodies Anti-DHX38 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHX38 Antibody

상품 한눈에 보기

Human DHX38 단백질을 인식하는 Rabbit Polyclonal Antibody로 IHC, WB, ICC에 적합합니다. DHX38(DDX38, hPrp16 등) 검출용으로 사용되며, 고순도 Affinity Purified 제품입니다. Human, Mouse, Rat에 반응성을 검증했습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041347-100 Anti-DHX38 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041347-25 Anti-DHX38 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHX38 Antibody

Anti-DHX38 Antibody

DEAH (Asp-Glu-Ala-His) box polypeptide 38

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human DHX38

Alternative Gene Names

DDX38, hPrp16, KIAA0224, PRP16, PRPF16

Open Datasheet

Target Information

항목 내용
Target Protein DEAH (Asp-Glu-Ala-His) box polypeptide 38
Target Gene DHX38
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000037993 (100%)
  • Rat ENSRNOG00000014619 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.