
Atlas Antibodies Anti-DHX38 Antibody
상품 한눈에 보기
Human DHX38 단백질을 인식하는 Rabbit Polyclonal Antibody로 IHC, WB, ICC에 적합합니다. DHX38(DDX38, hPrp16 등) 검출용으로 사용되며, 고순도 Affinity Purified 제품입니다. Human, Mouse, Rat에 반응성을 검증했습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DHX38 Antibody
DEAH (Asp-Glu-Ala-His) box polypeptide 38
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human DHX38
Alternative Gene Names
DDX38, hPrp16, KIAA0224, PRP16, PRPF16
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DEAH (Asp-Glu-Ala-His) box polypeptide 38 |
| Target Gene | DHX38 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000037993 (100%)
- Rat ENSRNOG00000014619 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DHX57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DHX40 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DHX38 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DHX38 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DHX35 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.