
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DHX38 Antibody
상품 한눈에 보기
Human DHX38 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. DHX38(DDX38, hPrp16 등) 타겟에 높은 특이성과 반응성을 보이며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat에 교차 반응합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041604-100 Anti-DHX38 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041604-25 Anti-DHX38 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DHX38 Antibody
Anti-DHX38 Antibody
Target: DEAH (Asp-Glu-Ala-His) box polypeptide 38
Type: Polyclonal Antibody against Human DHX38
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human DHX38 protein.
Alternative Gene Names
DDX38, hPrp16, KIAA0224, PRP16, PRPF16
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DEAH (Asp-Glu-Ala-His) box polypeptide 38 |
| Target Gene | DHX38 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000014619 (100%), Mouse ENSMUSG00000037993 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



