CacheBy
Atlas Antibodies Anti-DHX38 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHX38 Antibody

상품 한눈에 보기

Human DHX38 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. DHX38(DDX38, hPrp16 등) 타겟에 높은 특이성과 반응성을 보이며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat에 교차 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041604-100 Anti-DHX38 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 38 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041604-25 Anti-DHX38 Antibody, DEAH (Asp-Glu-Ala-His) box polypeptide 38 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHX38 Antibody

Anti-DHX38 Antibody

Target: DEAH (Asp-Glu-Ala-His) box polypeptide 38
Type: Polyclonal Antibody against Human DHX38


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human DHX38 protein.


Alternative Gene Names

DDX38, hPrp16, KIAA0224, PRP16, PRPF16

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein DEAH (Asp-Glu-Ala-His) box polypeptide 38
Target Gene DHX38
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MDEGYDEFHNPLAYSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRLEVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPE
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Rat ENSRNOG00000014619 (100%), Mouse ENSMUSG00000037993 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.