CacheBy
Atlas Antibodies Anti-DHX57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DHX57 Antibody

상품 한눈에 보기

Human DHX57 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 동일성을 보입니다. PBS/glycerol 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036160-100 Anti-DHX57 Antibody, DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036160-25 Anti-DHX57 Antibody, DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DHX57 Antibody

Anti-DHX57 Antibody

DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DHX57.

Alternative Gene Names

  • DDX57

Open Datasheet

Target Information

항목 내용
Target Protein DEAH (Asp-Glu-Ala-Asp/His) box polypeptide 57
Target Gene DHX57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000054272 (90%), Mouse ENSMUSG00000035051 (90%)

Antigen Sequence:

KRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATGEEANSNAENPKLISAMLCAALYPNVVQVKSPEGKFQKTSTGAVR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.