
Atlas Antibodies Anti-DGCR14 Antibody
상품 한눈에 보기
인간 DGCR14 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 단백질 발현을 확인함. 토끼 유래 IgG 형식이며, PrEST 항원으로 정제됨. 인간에 반응하며 랫 및 마우스 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DGCR14 Antibody
DiGeorge syndrome critical region gene 14
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant Expression): Recombinant expression validation in WB using target protein overexpression.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against Human DGCR14.
Alternative Gene Names
DGCR13, DGS-H, DGSI, ES2, Es2el
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DiGeorge syndrome critical region gene 14 |
| Target Gene | DGCR14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (86%), Mouse (85%) |
Antigen Sequence
ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDV
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DGCR2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DGCR8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DGCR14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DFNA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DGCR14 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.