
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DGCR14 Antibody
상품 한눈에 보기
인간 DGCR14 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 단백질 발현을 확인함. 토끼 유래 IgG 형식이며, PrEST 항원으로 정제됨. 인간에 반응하며 랫 및 마우스 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001222-100 Anti-DGCR14 Antibody, DiGeorge syndrome critical region gene 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001222-25 Anti-DGCR14 Antibody, DiGeorge syndrome critical region gene 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DGCR14 Antibody
Anti-DGCR14 Antibody
DiGeorge syndrome critical region gene 14
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant Expression): Recombinant expression validation in WB using target protein overexpression.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against Human DGCR14.
Alternative Gene Names
DGCR13, DGS-H, DGSI, ES2, Es2el
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DiGeorge syndrome critical region gene 14 |
| Target Gene | DGCR14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (86%), Mouse (85%) |
Antigen Sequence
ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDV
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



