
Atlas Antibodies Anti-DFNA5 Antibody
상품 한눈에 보기
Human DFNA5 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DFNA5 Antibody
Target: deafness, autosomal dominant 5 (DFNA5)
Type: Polyclonal Antibody against Human DFNA5
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against the human DFNA5 protein, also known as ICERE-1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | deafness, autosomal dominant 5 |
| Target Gene | DFNA5 |
| Alternative Gene Names | ICERE-1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV |
Species Reactivity
- Verified: Human
- Ortholog Identity:
- Rat: 67% (ENSRNOG00000009970)
- Mouse: 66% (ENSMUSG00000029821)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-DGCR8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DGCR14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DFNA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DGCR14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-DEXI Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.