CacheBy
Atlas Antibodies Anti-DFNA5 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DFNA5 Antibody

상품 한눈에 보기

Human DFNA5 단백질을 인식하는 rabbit polyclonal 항체로, IHC, WB, ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011326-100 Anti-DFNA5 Antibody, deafness, autosomal dominant 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011326-25 Anti-DFNA5 Antibody, deafness, autosomal dominant 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DFNA5 Antibody

Anti-DFNA5 Antibody

Target: deafness, autosomal dominant 5 (DFNA5)
Type: Polyclonal Antibody against Human DFNA5
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) — Genetic validation by siRNA knockdown
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against the human DFNA5 protein, also known as ICERE-1.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein deafness, autosomal dominant 5
Target Gene DFNA5
Alternative Gene Names ICERE-1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence VLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKPRQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSAAALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQRLFASADISLERLKSSV

Species Reactivity

  • Verified: Human
  • Ortholog Identity:
    • Rat: 67% (ENSRNOG00000009970)
    • Mouse: 66% (ENSMUSG00000029821)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Genetic Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.