
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DGCR14 Antibody
상품 한눈에 보기
Human DGCR14 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 사용 가능. 독립 항체 및 재조합 발현으로 검증됨. 높은 종 간 보존성을 가지며 친화 정제 방식으로 제조됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001221-100 Anti-DGCR14 Antibody, DiGeorge syndrome critical region gene 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001221-25 Anti-DGCR14 Antibody, DiGeorge syndrome critical region gene 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DGCR14 Antibody
Anti-DGCR14 Antibody
Target: DiGeorge syndrome critical region gene 14 (DGCR14)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Recombinant expression validation): Validation in WB using target protein overexpression.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal antibody against human DGCR14.
Alternative Gene Names
DGCR13, DGS-H, DGSI, ES2, Es2el
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DiGeorge syndrome critical region gene 14 |
| Target Gene | DGCR14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ASASSLLLPAASRPPRKREAGEAGAATSKQRVLDEEEYIEGLQTVIQRDFFPDVEKLQAQKEYLEAEENGDLERMRQIAIKFGSALGKMSREPPPPYVTPATFETPEVHAGTGVVGNKPRPRGRGLEDGEAGEEEEKEPLPSLDV |
Verified Species Reactivity
Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000000283 | 86% |
| Mouse | ENSMUSG00000003527 | 85% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Open Datasheet (PDF)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



